PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000948.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 174aa    MW: 19144.3 Da    PI: 6.5178
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000948.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.44.3e-5830127198
                    NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                              vreqdrflPian+srimkk+lP n+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plkvy
  Itr_sc000948.1_g00003.1  30 VREQDRFLPIANISRIMKKALPPNGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYLDPLKVY 115
                              69************************************************************************************ PP

                    NF-YB  87 lkkyrelegekk 98 
                              l++yre+eg++k
  Itr_sc000948.1_g00003.1 116 LTRYREMEGDTK 127
                              *********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.1E-5525141IPR009072Histone-fold
SuperFamilySSF471135.12E-4133138IPR009072Histone-fold
PfamPF008081.7E-2836100IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-206482No hitNo description
PROSITE patternPS0068506783IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.8E-2083101No hitNo description
PRINTSPR006151.8E-20102120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MSDGQASSQH PHSPGGGSHE SGEQSPRSNV REQDRFLPIA NISRIMKKAL PPNGKIAKDA  60
KETVQECVSE FISFITSEAS DKCQREKRKT INGDDLLWAM ATLGFEDYLD PLKVYLTRYR  120
EMEGDTKGSA KAADGPGKRD GMQPTPNMQL AHQGSFTQGM SYGNSQVFSL YVPD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-4830121192Transcription factor HapC (Eurofung)
4g92_B5e-4830121192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009620316.11e-106PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X3
RefseqXP_016449854.11e-106PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X1
SwissprotQ8VYK43e-80NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A0V0HS791e-104A0A0V0HS79_SOLCH; Putative nuclear transcription factor Y subunit B-10-like
STRINGGLYMA03G33490.17e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.12e-78nuclear factor Y, subunit B10